Growth HormoneResearch peptide

Tesamorelin

Tesamorelin is a stabilized analog of growth hormone-releasing hormone (GHRH) that stimulates endogenous GH secretion from the pituitary. It has been studied extensively in the context of visceral adipose tissue research.

Also known as: TH9507, Egrifta

Technical information

Molecular weight

5195.8 g/mol

Half-life

~26 minutes (subcutaneous)

Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Common research doses

1-2 mg/day (research protocols)

Research areas

GHRH analogVisceral fat researchIGF-1 studiesBody composition

For research purposes only. PepAssure provides vendor information as a verification service and does not endorse or recommend any specific use. Consult qualified research protocols and institutional review boards.