LL-37
LL-37 is the sole human cathelicidin-derived antimicrobial peptide, a 37-residue cationic host defense peptide. Research has characterized its direct antimicrobial activity and immunomodulatory signaling.
Also known as: Cathelicidin, hCAP-18, CAMP
Technical information
Molecular weight
4493.3 g/mol
Half-life
~1-2 hours (subcutaneous)
Sequence
[LL-37, 37 aa]
Common research doses
100-1000 mcg/day (research protocols)
Research areas
For research purposes only. PepAssure provides vendor information as a verification service and does not endorse or recommend any specific use. Consult qualified research protocols and institutional review boards.
Best Verified Vendors for LL-37
Ranked by PVS score — independent verification, no paid placements.
Competitive landscape
Multi-signal comparison of every verified vendor selling LL-37 — PVS, purity, CoA cadence, sentiment, and 30-day momentum.
Market overview
Aggregate signals across vendors selling LL-37
Side-by-side comparison
All verified vendors selling LL-37. Click a column header to sort. ★ marks the leader on that column.
| Vendor | PVS | Purity | CoAs | Sentiment | 30d Δ | Lab | Price |
|---|---|---|---|---|---|---|---|
| 1Trident Peptides | ★88 | — | ★0 | ★89 | ★0.0 | Janoshik | $$ |
| 2Behemoth Labz | 82 | — | ★0 | 84 | ★0.0 | Janoshik | $$$ |
Pillar leaders
Top-scoring vendor on each of the five PVS pillars
Recent purity track record
Approved community CoAs for LL-37, newest first