All peptides
ImmuneResearch peptide
LL-37
LL-37 is the sole human cathelicidin-derived antimicrobial peptide, a 37-residue cationic host defense peptide. Research has characterized its direct antimicrobial activity and immunomodulatory signaling.
Also known as: Cathelicidin, hCAP-18, CAMP
Technical information
Molecular weight
4493.3 g/mol
Half-life
~1-2 hours (subcutaneous)
Sequence
[LL-37, 37 aa]
Common research doses
100-1000 mcg/day (research protocols)
Research areas
Antimicrobial peptideHost defenseWound researchBiofilm studies
For research purposes only. PepAssure provides vendor information as a verification service and does not endorse or recommend any specific use. Consult qualified research protocols and institutional review boards.
Best Verified Vendors for LL-37
Ranked by PVS score — independent verification, no paid placements.