Skip to content
All peptides
ImmuneResearch peptide

LL-37

LL-37 is the sole human cathelicidin-derived antimicrobial peptide, a 37-residue cationic host defense peptide. Research has characterized its direct antimicrobial activity and immunomodulatory signaling.

Also known as: Cathelicidin, hCAP-18, CAMP

Technical information

Molecular weight

4493.3 g/mol

Half-life

~1-2 hours (subcutaneous)

Sequence

[LL-37, 37 aa]

Common research doses

100-1000 mcg/day (research protocols)

Research areas

Antimicrobial peptideHost defenseWound researchBiofilm studies

For research purposes only. PepAssure provides vendor information as a verification service and does not endorse or recommend any specific use. Consult qualified research protocols and institutional review boards.

Best Verified Vendors for LL-37

Ranked by PVS score — independent verification, no paid placements.

Competitive landscape

Multi-signal comparison of every verified vendor selling LL-37 — PVS, purity, CoA cadence, sentiment, and 30-day momentum.

Market overview

Aggregate signals across vendors selling LL-37

0.030d
Verified vendors
2
selling this peptide
Median PVS
45.5
across vendors above
Avg reported purity
—
no community CoAs yet
CoAs on record
0
approved community submissions

Side-by-side comparison

All verified vendors selling LL-37. Click a column header to sort. ★ marks the leader on that column.

VendorPVSPurityCoAsSentiment30d ΔLabPrice
1Behemoth Labz★51—★084★0.0——
2Trident Peptides40—★0★89★0.0——

Recent purity track record

Approved community CoAs for LL-37, newest first

No community CoAs have been submitted for this peptide yet.