Skip to content
All peptides
ImmuneResearch peptide

LL-37

LL-37 is the sole human cathelicidin-derived antimicrobial peptide, a 37-residue cationic host defense peptide. Research has characterized its direct antimicrobial activity and immunomodulatory signaling.

Also known as: Cathelicidin, hCAP-18, CAMP

Technical information

Molecular weight

4493.3 g/mol

Half-life

~1-2 hours (subcutaneous)

Sequence

[LL-37, 37 aa]

Common research doses

100-1000 mcg/day (research protocols)

Research areas

Antimicrobial peptideHost defenseWound researchBiofilm studies

For research purposes only. PepAssure provides vendor information as a verification service and does not endorse or recommend any specific use. Consult qualified research protocols and institutional review boards.

Best Verified Vendors for LL-37

Ranked by PVS score — independent verification, no paid placements.