Skip to content
All peptides
Growth HormoneResearch peptide

CJC-1295

CJC-1295 is a synthetic analog of growth hormone-releasing hormone (GHRH). Research studies its effects on growth hormone secretion, with particular interest in its extended half-life version (CJC-1295 with DAC).

Also known as: Modified GRF 1-29

Technical information

Molecular weight

3367.9 g/mol

Half-life

~30 min (no DAC), ~6-8 days (with DAC)

Sequence

Y-Aib-DAIFTQSYRKVLAQLSARKLLQDIMSRQQGESNQERGARARL

Common research doses

1-2 mg/week (research protocols)

Research areas

GH secretionBody composition researchSleep studiesRecovery research

For research purposes only. PepAssure provides vendor information as a verification service and does not endorse or recommend any specific use. Consult qualified research protocols and institutional review boards.

Best Verified Vendors for CJC-1295

Ranked by PVS score — independent verification, no paid placements.