CJC-1295
CJC-1295 is a synthetic analog of growth hormone-releasing hormone (GHRH). Research studies its effects on growth hormone secretion, with particular interest in its extended half-life version (CJC-1295 with DAC).
Also known as: Modified GRF 1-29
Technical information
Molecular weight
3367.9 g/mol
Half-life
~30 min (no DAC), ~6-8 days (with DAC)
Sequence
Y-Aib-DAIFTQSYRKVLAQLSARKLLQDIMSRQQGESNQERGARARL
Common research doses
1-2 mg/week (research protocols)
Research areas
For research purposes only. PepAssure provides vendor information as a verification service and does not endorse or recommend any specific use. Consult qualified research protocols and institutional review boards.
Best Verified Vendors for CJC-1295
Ranked by PVS score — independent verification, no paid placements.
USA · 99.4% reported purity · 62+ COAs
Canada · 99.4% reported purity · 58+ COAs
Canada · 99.4% reported purity · 130+ COAs
Canada · 99.3% reported purity · 58+ COAs
Canada · 99.3% reported purity · 114+ COAs
EU · 99.3% reported purity · 131+ COAs
UK · 99.3% reported purity · 148+ COAs
EU · 99.2% reported purity · 99+ COAs
USA · 99.2% reported purity · 134+ COAs
International · 99.2% reported purity · 61+ COAs
USA · 99.2% reported purity · 97+ COAs
USA · 99.2% reported purity · 97+ COAs
USA · 99.2% reported purity · 135+ COAs
USA · 99.2% reported purity · 73+ COAs
UK · 99.1% reported purity · 116+ COAs
USA · 99.1% reported purity · 86+ COAs
EU · 99.1% reported purity · 67+ COAs
USA · 99.1% reported purity · 137+ COAs
International · 99.0% reported purity · 53+ COAs
UK · 99.0% reported purity · 140+ COAs
Canada · 99.0% reported purity · 42+ COAs